PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast03G074200.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family WRKY
Protein Properties Length: 572aa    MW: 62665.3 Da    PI: 6.7252
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast03G074200.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY90.21.7e-28247303259
                         --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          Dg+nWrKYGqK+vk+s+++rsYYrCt ++C +kkkve+   d++v+ei+Y+g+H he
  Brast03G074200.2.p 247 GDGFNWRKYGQKQVKSSDNSRSYYRCTNSSCLAKKKVEHYP-DGRVIEIIYRGTHSHE 303
                         6****************************************.***************8 PP

2WRKY101.64.5e-32418475259
                         --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         +Dgy+WrKYGqK vkg+++prsYYrCt+ gCpv+k+ve++a+d + +++tYeg+Hnh+
  Brast03G074200.2.p 418 SDGYRWRKYGQKIVKGNPNPRSYYRCTHDGCPVRKHVEKAADDINNMVVTYEGKHNHD 475
                         8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.9E-24236305IPR003657WRKY domain
SuperFamilySSF1182901.57E-22240305IPR003657WRKY domain
PROSITE profilePS5081120.977241305IPR003657WRKY domain
SMARTSM007742.5E-28246304IPR003657WRKY domain
PfamPF031061.3E-21248302IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.4E-31411477IPR003657WRKY domain
PROSITE profilePS5081133.132412477IPR003657WRKY domain
SuperFamilySSF1182901.27E-27412477IPR003657WRKY domain
SMARTSM007748.2E-37417476IPR003657WRKY domain
PfamPF031061.2E-25419475IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 572 aa     Download sequence    Send to blast
MADGEPVAPA EGKRPAVEAA SAEAEKHPPP EPPESTSAET KPEKEVEMET EANEVGKAEP  60
KEMMETEASE VGKAEPKEMM EKEEAAEPKE AKPKEVKEAA EPKEKEKEAE PKEAVKVKVE  120
KKEKEKAEIG ATRRPPGSSP DAPILAVPMV AVPCFIAPPG FAFAMSHQAA LASVTAQAHM  180
QLQSPTSSAY SEGLPSPFPR PITPIAIRPL QQAPSVTQGN VCRPMAERPS SSELKVHHHQ  240
VAVNMVGDGF NWRKYGQKQV KSSDNSRSYY RCTNSSCLAK KKVEHYPDGR VIEIIYRGTH  300
SHEPPEKTRF VKERLPHINV SPRGEQALRL VNTEIMESSR TQTPTSKKLN KTAVENSEQQ  360
LFCSSDCEGD AGIKSEDEHP SAEPQPKRRI VEATTPNSSP VLRTVREQKI IVQAGKMSDG  420
YRWRKYGQKI VKGNPNPRSY YRCTHDGCPV RKHVEKAADD INNMVVTYEG KHNHDQPFKS  480
SNESRDGSIS LITPAVTTTD QTVTVASISD QKPPTSTQKT ADTESIKDTT LEHGGEKGVE  540
SAQTLLTVTN PDDMKNSLLK DTSAVVPVQN N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-264174771777Probable WRKY transcription factor 4
1wj2_A2e-264174771777Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003571606.10.0PREDICTED: probable WRKY transcription factor 32
TrEMBLA0A0Q3I5Q00.0A0A0Q3I5Q0_BRADI; Uncharacterized protein
STRINGBRADI3G19640.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-65WRKY DNA-binding protein 4